powered by:
Protein Alignment Cam and AIF1
DIOPT Version :9
Sequence 1: | NP_001246276.1 |
Gene: | Cam / 36329 |
FlyBaseID: | FBgn0000253 |
Length: | 149 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005248927.1 |
Gene: | AIF1 / 199 |
HGNCID: | 352 |
Length: | 186 |
Species: | Homo sapiens |
Alignment Length: | 141 |
Identity: | 27/141 - (19%) |
Similarity: | 42/141 - (29%) |
Gaps: | 66/141 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 ADQLTEEQIAEFKEAFSLFDKDGDGTITTK-------------------------ELG------- 34
:|:....::..|||.:..||.:|:|.|..| :||
Human 39 SDEDLPSKLEGFKEKYMEFDLNGNGDIGEKRVICGGRVVCRPKKTEVSPTCSIPHDLGGGPPTTV 103
Fly 35 ----------------------------------TVMRSLGQNPTEAELQDMINEVDADGNGTID 65
.::..||...|..||:.:|.||.:....|..
Human 104 GGRRMGMRKWERRERVSPPSPHPHPLPPDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFS 168
Fly 66 FPEFLTMMARK 76
:|:||.||..|
Human 169 YPDFLRMMLGK 179
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cam | NP_001246276.1 |
PTZ00184 |
1..149 |
CDD:185504 |
27/141 (19%) |
AIF1 | XP_005248927.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.