DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cal-5

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_508864.2 Gene:cal-5 / 192083 WormBaseID:WBGene00006861 Length:156 Species:Caenorhabditis elegans


Alignment Length:138 Identity:53/138 - (38%)
Similarity:78/138 - (56%) Gaps:4/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76
            :.|..|..||.:|||.|..:||..||:.:||:|||.||..|....|.|.:|.|||.|||.:    
 Worm    22 DLKGIFREFDLNGDGYIQREELRAVMQKMGQSPTEDELDAMFQAADKDCDGNIDFQEFLVI---- 82

  Fly    77 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 141
            .|.......::..|...|.||:|:|:.:|||.....:|..|:|:::..:.|..|.:.||::|::|
 Worm    83 AKANPLSLSLKAVFEELDVDGDGYITRSELRTAFQRMGHSLSDQDIKAIYRHVDQNNDGKINFQE 147

  Fly   142 FVTMMTSK 149
            |..|||.|
 Worm   148 FCEMMTRK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 52/136 (38%)
cal-5NP_508864.2 PTZ00184 22..155 CDD:185504 52/136 (38%)
EFh 22..84 CDD:238008 29/65 (45%)
EFh 92..153 CDD:238008 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.