DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and T09B4.4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_491778.2 Gene:T09B4.4 / 188316 WormBaseID:WBGene00020378 Length:142 Species:Caenorhabditis elegans


Alignment Length:133 Identity:30/133 - (22%)
Similarity:69/133 - (51%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTID 65
            |.:..:::||.|.:|.|:.:...| ...|..:|...:||||.:||.::......:::   ...|:
 Worm     1 MTEFFSQKQIDEIRECFNFYSTSG-VLRTDSQLRCALRSLGYSPTASKTDIYFKKLN---KKPIE 61

  Fly    66 FPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREAD 130
            |..||.:...:....:...||.:|....|::....:.:.||..:::::||:::.||:..::.:.:
 Worm    62 FATFLDICKDEQNSPNPLTEIIKALSGLDRNKTRAMPSRELAAILSHVGEQMSPEEIKYLLSKVE 126

  Fly   131 IDG 133
            ::|
 Worm   127 VNG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 30/133 (23%)
T09B4.4NP_491778.2 PTZ00183 5..129 CDD:185503 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.