DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and R08D7.5

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_498986.3 Gene:R08D7.5 / 187699 WormBaseID:WBGene00011145 Length:168 Species:Caenorhabditis elegans


Alignment Length:130 Identity:43/130 - (33%)
Similarity:68/130 - (52%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ELGTVMRSLGQNPTEAELQDMINEVDADGNGTI----------DFPEFLTMMARKMKDTDSEE-- 84
            :|..|:|:||.:|..:::|:|..:: .||...:          |..|....:..|..:.||.|  
 Worm    34 QLKMVLRALGYDPRNSKVQEMTRKI-KDGRSMVMGWHGEKDYMDVDELWNALQSKDDEGDSTEDK 97

  Fly    85 ---EIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVTMM 146
               |:|.||::||.:..|.|:.|.|:.|...|||.|.|.:.|||||||..|.:..:|.::|..:|
 Worm    98 VTTEMRSAFKLFDPESKGTITVANLKMVAKELGETLADADFDEMIREAGGDNNTGINEQQFFEIM 162

  Fly   147  146
             Worm   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 43/130 (33%)
R08D7.5NP_498986.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.