DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and chpf-2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_503830.2 Gene:chpf-2 / 186617 WormBaseID:WBGene00019108 Length:195 Species:Caenorhabditis elegans


Alignment Length:164 Identity:44/164 - (26%)
Similarity:86/164 - (52%) Gaps:26/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEV-----DADG--- 60
            |..:.||......|:..||:|.|.::..:...| ..|..||    |.|.|.:.     |:||   
 Worm    22 QFNKHQILRLYTRFASLDKNGQGYLSRDDFLNV-PELAVNP----LGDRIIDAFFTLGDSDGDSK 81

  Fly    61 NGTIDFPEFLTMMAR-----KMKD---TDSEEEIREAFRVFDKDGNGFISAAELRHVMTNL-GEK 116
            :|.:.|.:|:.::|.     |:||   ...::::|.||:::|.:.|.:|:..|.:.::.:: |..
 Worm    82 SGQLTFRQFVRILAHFQPISKVKDNALNSRKDKLRFAFKMYDLNKNNYITREEFKVILNSMVGAN 146

  Fly   117 LTDEEVDEM----IREADIDGDGQVNYEEFVTMM 146
            :|.:::|::    :.|||.|.||::::|:|...|
 Worm   147 ITSDQLDKIADKTLEEADQDRDGKISFEDFCRAM 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 44/164 (27%)
chpf-2NP_503830.2 FRQ1 15..182 CDD:227455 44/164 (27%)
EFh 35..95 CDD:298682 18/64 (28%)
EFh 114..180 CDD:238008 18/65 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.