DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and C56C10.9

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_495338.1 Gene:C56C10.9 / 183859 WormBaseID:WBGene00016965 Length:320 Species:Caenorhabditis elegans


Alignment Length:146 Identity:37/146 - (25%)
Similarity:64/146 - (43%) Gaps:30/146 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQLTEEQIAE-FKEAFSLFDKDGDGTITTKELGTVMRS-----LGQNPTEAELQDMINEVDADGN 61
            |....:|::| .||.|...|.:.||.:|..||...:|.     |.::..::|:  ..:.||.:.:
 Worm    56 DPSDSKQLSESIKEMFKKTDVNDDGFLTAGELKQQIRKNMEEHLEKSKNDSEI--FFDIVDTNKD 118

  Fly    62 GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMI 126
            |:|.:.||....: ||.:.|.                   |.:||..|.|....::.||:  .|.
 Worm   119 GSIVWEEFEPHFS-KMHEKDH-------------------SDSELMDVHTEDPHRVDDEK--RMF 161

  Fly   127 READIDGDGQVNYEEF 142
            ..:||..||:::..|:
 Worm   162 NRSDITRDGRLDRMEW 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 37/146 (25%)
C56C10.9NP_495338.1 EF-hand_7 67..127 CDD:290234 17/61 (28%)
EFh 67..126 CDD:298682 16/60 (27%)
FRQ1 <194..289 CDD:227455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.