DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and C50C3.5

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_498786.3 Gene:C50C3.5 / 183642 WormBaseID:WBGene00016801 Length:189 Species:Caenorhabditis elegans


Alignment Length:147 Identity:43/147 - (29%)
Similarity:78/147 - (53%) Gaps:9/147 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :::::::.:..:.|.|.|.||.|||::.|:..::..||.:.:...:|.::...|..|:|.|||.|
 Worm    43 EVSKQEVEKVFKIFQLMDDDGSGTISSSEVAKMLNELGIDVSPKVVQAVMRSSDVSGDGQIDFEE 107

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAEL-----RHVMTNLGEKLTDEEVDEMIRE 128
            ||..:..|:|.:..:.:::......|.:....|||.||     ..|.||    :|.:|...:|::
 Worm   108 FLAAVTSKIKLSTVKADVQLMLSKIDNNPEKVISAEELVVAWSETVSTN----ITVKEACALIQQ 168

  Fly   129 ADIDGDGQVNYEEFVTM 145
            ||..|.|:....||:||
 Worm   169 ADTQGRGKATIHEFITM 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 43/147 (29%)
C50C3.5NP_498786.3 FRQ1 35..186 CDD:227455 43/147 (29%)
EFh 51..113 CDD:238008 21/61 (34%)
EFh 96..150 CDD:298682 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.