DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cal-2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_495906.2 Gene:cal-2 / 182789 WormBaseID:WBGene00000286 Length:171 Species:Caenorhabditis elegans


Alignment Length:146 Identity:94/146 - (64%)
Similarity:118/146 - (80%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFP 67
            |.|.||:|.|:|.||.||||||:|:|::||||..||||||||||.||.||:||||.||:|||||.
 Worm    27 DGLNEEEIMEYKAAFRLFDKDGNGSISSKELGVAMRSLGQNPTEQELLDMVNEVDIDGSGTIDFG 91

  Fly    68 EFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID 132
            ||..||.|..|:.|| |.|||||||||:||||||:|.|.|:.||::|::.:|:||||:|.|.|||
 Worm    92 EFCQMMKRMNKENDS-EMIREAFRVFDRDGNGFITADEFRYFMTHMGDQFSDQEVDEIIAEIDID 155

  Fly   133 GDGQVNYEEFVTMMTS 148
            ||||::||||.:..::
 Worm   156 GDGQIDYEEFASTFSA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 94/146 (64%)
cal-2NP_495906.2 PTZ00184 27..165 CDD:185504 92/138 (67%)
EFh 36..98 CDD:238008 44/61 (72%)
EFh 108..166 CDD:238008 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.