DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and B0563.7

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:144 Identity:55/144 - (38%)
Similarity:91/144 - (63%) Gaps:5/144 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL 70
            |.:::.|:::.|::||.||.|.|..:||...|.|:|.:..:||:.::|.||||||||.|||.||.
 Worm    46 TRKELKEYRQLFNMFDTDGSGAIGNEELKQAMISIGLHANKAEIDNVIKEVDADGNGEIDFEEFC 110

  Fly    71 TMMARK---MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADID 132
            ..|.:.   :|.| :||.|||.|.:||:|.||.|:..|.:::....|: ..||..:::.||.|:.
 Worm   111 ACMKKSQNIVKST-NEELIRECFEIFDQDRNGIITENEFKYIAKEFGD-FDDELAEKVFRELDVS 173

  Fly   133 GDGQVNYEEFVTMM 146
            .:|.::.::|.|::
 Worm   174 ANGHLSADQFATIV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 55/144 (38%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 53/138 (38%)
EFh 52..114 CDD:238008 29/61 (48%)
EFh 88..153 CDD:238008 31/65 (48%)
EFh 128..187 CDD:238008 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.