DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and F43C9.2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_508818.1 Gene:F43C9.2 / 180753 WormBaseID:WBGene00018376 Length:159 Species:Caenorhabditis elegans


Alignment Length:138 Identity:43/138 - (31%)
Similarity:72/138 - (52%) Gaps:6/138 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARK 76
            :..|.|.|.|.|.||.::..|:..::|::...||..||..:..|:|.|..|.|...||:..|...
 Worm    23 QLSETFDLLDVDKDGRLSRNEIAALLRTINVEPTRVELDFIFGEMDTDKTGKISKEEFVNYMKSP 87

  Fly    77 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM---TNLGEKLTDEEVDEMIREADIDGDGQVN 138
            .....:..|:...||.||.||:|.|:..|:..::   .:||::..   :.:|.:..|::|||::.
 Worm    88 PIHRTTLRELEVQFRKFDSDGDGAITEDEMAEILRRTADLGDRAA---ISDMFKATDLNGDGKIT 149

  Fly   139 YEEFVTMM 146
            :.|||.||
 Worm   150 FFEFVKMM 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 43/138 (31%)
F43C9.2NP_508818.1 EF-hand_7 24..84 CDD:290234 20/59 (34%)
EFh 25..85 CDD:298682 20/59 (34%)
EFh 96..158 CDD:238008 22/65 (34%)
EF-hand_7 101..157 CDD:290234 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.