DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and ncs-1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_508186.1 Gene:ncs-1 / 180448 WormBaseID:WBGene00003563 Length:191 Species:Caenorhabditis elegans


Alignment Length:158 Identity:39/158 - (24%)
Similarity:77/158 - (48%) Gaps:20/158 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQ--LTEEQIAEFKEAFSLFDKD-GDGTITTKELGTVMRSLGQNPTEAELQDMINEV-DADGN 61
            :|:|  .||::|   |:.:..|.:| .:|.:|......:.:........::....:.:| |.:.:
 Worm    16 LAEQTYFTEKEI---KQWYKGFVRDCPNGMLTEAGFQKIYKQFFPQGDPSDFASFVFKVFDENKD 77

  Fly    62 GTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHV------MTNLGEKLTDE 120
            |.|:|.||:..::...:. :.:|::..||:::|.|.:|||:..|:..:      |.....:|.:|
 Worm    78 GAIEFHEFIRALSITSRG-NLDEKLHWAFKLYDLDQDGFITRNEMLSIVDSIYKMVGSSVQLPEE 141

  Fly   121 E------VDEMIREADIDGDGQVNYEEF 142
            |      ||.:.|..|.:.|.|:..|||
 Worm   142 ENTPEKRVDRIFRMMDKNNDAQLTLEEF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 39/158 (25%)
ncs-1NP_508186.1 FRQ1 11..179 CDD:227455 39/158 (25%)
EFh 67..125 CDD:238008 16/58 (28%)
EFh 100..174 CDD:238008 21/70 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.