DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cal-1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001256428.1 Gene:cal-1 / 179715 WormBaseID:WBGene00000285 Length:180 Species:Caenorhabditis elegans


Alignment Length:146 Identity:98/146 - (67%)
Similarity:122/146 - (83%) Gaps:1/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            |||.|:|.||:|||.:|||||:|||:|||||..||||||||||.|:.:||||||.||||.|:|||
 Worm    36 QLTPEEIDEFREAFMMFDKDGNGTISTKELGIAMRSLGQNPTEQEILEMINEVDIDGNGQIEFPE 100

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133
            |..||.|.||:||| |.||||||||||||||.|:|.|.|:.|.::|.:.::|||||||:|.|:||
 Worm   101 FCVMMKRMMKETDS-EMIREAFRVFDKDGNGVITAQEFRYFMVHMGMQFSEEEVDEMIKEVDVDG 164

  Fly   134 DGQVNYEEFVTMMTSK 149
            ||:::|||||.||:::
 Worm   165 DGEIDYEEFVKMMSNQ 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 98/144 (68%)
cal-1NP_001256428.1 EFh_PEF 36..177 CDD:330173 96/141 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.