DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Myl3

DIOPT Version :10

Sequence 1:NP_523710.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_034989.1 Gene:Myl3 / 17897 MGIID:97268 Length:204 Species:Mus musculus


Alignment Length:146 Identity:66/146 - (45%)
Similarity:96/146 - (65%) Gaps:7/146 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDK--DGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDAD--GNGTI 64
            :.|.|||.||||||.|||:  .|:..||..:.|.|:|:||||||:||:..::.:...:  .:..:
Mouse    54 EFTPEQIEEFKEAFLLFDRTPKGEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMM 118

  Fly    65 DFPEFLTMMAR--KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIR 127
            ||..||.|:..  |.|||.:.|:..|..|||||:|||.:..||||||:..|||:||::||::::.
Mouse   119 DFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMA 183

  Fly   128 EADIDGDGQVNYEEFV 143
            ..: |.:|.:|||.||
Mouse   184 GQE-DSNGCINYEAFV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_523710.1 PTZ00184 1..149 CDD:185504 66/146 (45%)
Myl3NP_034989.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
PTZ00184 53..203 CDD:185504 66/146 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.