DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and cal-3

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:144 Identity:85/144 - (59%)
Similarity:113/144 - (78%) Gaps:1/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            |||||:|.||||||.||||||:|||:.||||..||:|||||||.::.::|::||.||||.::|||
 Worm    92 QLTEEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVEFPE 156

  Fly    69 FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDG 133
            |..||.|.||:||| |.|||||::||:||||.|:|.|.:..|.|:|....:.||:||:.|.|.||
 Worm   157 FCVMMKRIMKETDS-EMIREAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDG 220

  Fly   134 DGQVNYEEFVTMMT 147
            :|:::|||||.:.:
 Worm   221 NGEIDYEEFVKIFS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 85/144 (59%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 85/140 (61%)
EFh 100..162 CDD:238008 40/61 (66%)
EFh 172..234 CDD:238008 31/61 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D600030at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.