DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and mlc-3

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_741145.1 Gene:mlc-3 / 175768 WormBaseID:WBGene00003371 Length:153 Species:Caenorhabditis elegans


Alignment Length:133 Identity:50/133 - (37%)
Similarity:79/133 - (59%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI-NEVDADGNGTIDFPEFLTMMAR-- 75
            ||.|:|:|::.||.|...::|.|.|:.|..||:|.:.... .|....|...:.|.|:|.|..:  
 Worm    10 KEIFNLYDEELDGKIDGTQVGDVARAAGLKPTQAMVTKAAGQEFKRKGEKRLTFEEWLPMYEQLA 74

  Fly    76 KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE 140
            |.|:..:..:..|..:||||:..|.|.||||||::..|||:|:.:|.||:::..: ||:|.|.||
 Worm    75 KEKEQGTYADFYEGLKVFDKEETGKILAAELRHILLALGERLSADEADELLKGVE-DGEGMVKYE 138

  Fly   141 EFV 143
            :|:
 Worm   139 DFI 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 50/133 (38%)
mlc-3NP_741145.1 EF-hand_7 9..70 CDD:290234 20/59 (34%)
EFh 90..142 CDD:298682 26/53 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.