DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and H10E21.4

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_497128.1 Gene:H10E21.4 / 175168 WormBaseID:WBGene00019184 Length:236 Species:Caenorhabditis elegans


Alignment Length:137 Identity:40/137 - (29%)
Similarity:70/137 - (51%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTM---MARK 76
            ::|.|.|.:.||.::.|||.|.||..|:    .:.|:.....|.|.||.:|..||:.:   |:|:
 Worm    21 DSFDLVDANNDGKLSEKELITFMRKRGR----PDGQEYFQRFDLDRNGHLDISEFVPLVYEMSRR 81

  Fly    77 MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 141
            ..|.|     .|.|:..|.:.:|.:..||:..:..:..:::    :|.::..||.:.|||:.|.|
 Worm    82 PVDMD-----YEFFKKMDLNDDGIVDKAEVEKIRKDNNDRI----IDGILSIADTNRDGQLTYAE 137

  Fly   142 FVTMMTS 148
            |...::|
 Worm   138 FKNHLSS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 40/137 (29%)
H10E21.4NP_497128.1 EF-hand_7 21..75 CDD:290234 20/57 (35%)
EFh 23..72 CDD:238008 19/52 (37%)
EF-hand_7 87..139 CDD:290234 14/55 (25%)
EFh 88..143 CDD:298682 15/58 (26%)
EF-hand_7 161..219 CDD:290234
EFh 166..221 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.