DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and calm-1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_492514.2 Gene:calm-1 / 172774 WormBaseID:WBGene00009260 Length:201 Species:Caenorhabditis elegans


Alignment Length:167 Identity:44/167 - (26%)
Similarity:82/167 - (49%) Gaps:34/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TEEQIAEFKEAFSLFDKD---------------------GD----GTITTKELGTVMRSLGQNPT 45
            |.||:.|:::......||                     |:    .|:|.:|: ..|..|.:||.
 Worm    21 TREQLDEYQDCTFFTRKDIIRLYKRFYALNPHKVPTNMQGNRPAITTLTFEEV-EKMPELKENPF 84

  Fly    46 EAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVM 110
            :..:.::.:|   ||.|.:.|.:||.|.:...:....:.:::.|||::|.||:..:...:|..::
 Worm    85 KRRICEVFSE---DGRGNLSFDDFLDMFSVFSEMAPLQLKLKYAFRIYDYDGDELLGHDDLSKMI 146

  Fly   111 TNL-GEKLTDEEV----DEMIREADIDGDGQVNYEEF 142
            .:| .::|:|.||    :.:|.|||:|||..:|:.||
 Worm   147 RSLTRDELSDVEVEFIIERIIEEADLDGDSSINFAEF 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 44/167 (26%)
calm-1NP_492514.2 FRQ1 32..192 CDD:227455 40/156 (26%)
EFh 121..183 CDD:298682 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.