DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Ncs1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_062655.1 Gene:Ncs1 / 14299 MGIID:109166 Length:190 Species:Mus musculus


Alignment Length:144 Identity:34/144 - (23%)
Similarity:67/144 - (46%) Gaps:32/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMAR 75
            |.|::.:..|...||.|    :..|.               :.|..|.:.:|.|:|.||:..::.
Mouse    46 AGFQKIYKQFFPFGDPT----KFATF---------------VFNVFDENKDGRIEFSEFIQALSV 91

  Fly    76 KMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE------KLTDEE------VDEMIRE 128
            ..:.| .:|::|.||:::|.|.:|:|:..|:..::..:.:      :|.:||      ||.:...
Mouse    92 TSRGT-LDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAM 155

  Fly   129 ADIDGDGQVNYEEF 142
            .|.:.||::..:||
Mouse   156 MDKNADGKLTLQEF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 34/144 (24%)
Ncs1NP_062655.1 FRQ1 20..179 CDD:227455 34/144 (24%)
Interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:P62166 174..190
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.