DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cam and AgaP_AGAP004737

DIOPT Version :9

Sequence 1:	NP_001246276.1	Gene:	Cam / 36329	FlyBaseID:	FBgn0000253	Length:	149	Species:	Drosophila melanogaster
Sequence 2:	XP_318085.4	Gene:	AgaP_AGAP004737 / 1278488	VectorBaseID:	AGAP004737	Length:	361	Species:	Anopheles gambiae

Alignment Length:	62	Identity:	16/62 - (25%)
Similarity:	37/62 - (59%)	Gaps:	5/62 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    84 EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVD---EMIREADIDGDGQVNYEEF 142
            :.:|..|..:|.|.:|:::..|::|::..  :|..|...|   .:::.:|.:.||::::|||
Mosquito    26 QHLRHVFEKYDSDSDGYLNIVEMKHLIHE--KKCADMPKDLALHLLKLSDTNNDGRLDFEEF 85

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cam	NP_001246276.1	PTZ00184	1..149	CDD:185504	16/62 (26%)
AgaP_AGAP004737	XP_318085.4	EFh	27..88	CDD:238008	16/61 (26%)
		EF-hand_7	28..88	CDD:290234	16/60 (27%)
		Rhomboid	177..323	CDD:279958
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910