DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AgaP_AGAP004737

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_318085.4 Gene:AgaP_AGAP004737 / 1278488 VectorBaseID:AGAP004737 Length:361 Species:Anopheles gambiae


Alignment Length:62 Identity:16/62 - (25%)
Similarity:37/62 - (59%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 EEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVD---EMIREADIDGDGQVNYEEF 142
            :.:|..|..:|.|.:|:::..|::|::..  :|..|...|   .:::.:|.:.||::::|||
Mosquito    26 QHLRHVFEKYDSDSDGYLNIVEMKHLIHE--KKCADMPKDLALHLLKLSDTNNDGRLDFEEF 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 16/62 (26%)
AgaP_AGAP004737XP_318085.4 EFh 27..88 CDD:238008 16/61 (26%)
EF-hand_7 28..88 CDD:290234 16/60 (27%)
Rhomboid 177..323 CDD:279958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.