DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AgaP_AGAP007963

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_317508.3 Gene:AgaP_AGAP007963 / 1277988 VectorBaseID:AGAP007963 Length:191 Species:Anopheles gambiae


Alignment Length:89 Identity:25/89 - (28%)
Similarity:36/89 - (40%) Gaps:27/89 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 DADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAA---ELRHVMTNLGEKLT 118
            |.|.||.:|..:|..|                |.|....:|.|.|:.|   |.:.:|.:|.    
Mosquito    18 DIDNNGFLDNNDFQCM----------------ALRATVIEGKGEINPARLNEYKFIMKSLW---- 62

  Fly   119 DEEVDEMIREADIDGDGQVNYEEF 142
                ||:...||.|.||::..:||
Mosquito    63 ----DEISALADFDKDGKITTDEF 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 25/89 (28%)
AgaP_AGAP007963XP_317508.3 EFh 15..87 CDD:298682 25/89 (28%)
EF-hand_7 16..86 CDD:290234 25/89 (28%)
EF-hand_7 68..128 CDD:290234 7/15 (47%)
EFh 70..125 CDD:298682 6/13 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.