DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AgaP_AGAP006181

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_316246.4 Gene:AgaP_AGAP006181 / 1276848 VectorBaseID:AGAP006181 Length:154 Species:Anopheles gambiae


Alignment Length:150 Identity:53/150 - (35%)
Similarity:95/150 - (63%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE 68
            :|:::|:...||:|..||.:..|:|:.:.:||::..|||..:|.||::::.|.|.|.:|.|:|.|
Mosquito     5 ELSKDQMKILKESFEAFDIEKKGSISVEVVGTILELLGQTLSEEELKEVMEEYDVDESGQIEFDE 69

  Fly    69 FLTMMARKM---KDTDS-EEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREA 129
            ||.:.:..:   :|.|: ..|:||.|.::||:|.|||.....:.::..|...:.:.|:|::|.|.
Mosquito    70 FLELASNFVEPEEDYDALRAELREVFMMYDKNGTGFIPLDVFKKILQELDGAVPENELDDIIDEI 134

  Fly   130 DIDGDGQVNYEEFVTMMTSK 149
            |.||.|.|::|||:.:||.:
Mosquito   135 DADGSGTVDFEEFMEVMTGE 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 53/148 (36%)
AgaP_AGAP006181XP_316246.4 FRQ1 1..154 CDD:227455 53/148 (36%)
EFh 14..75 CDD:298682 24/60 (40%)
EFh 90..152 CDD:238008 23/61 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.