DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and AgaP_AGAP002536

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_312402.5 Gene:AgaP_AGAP002536 / 1273426 VectorBaseID:AGAP002536 Length:285 Species:Anopheles gambiae


Alignment Length:146 Identity:77/146 - (52%)
Similarity:109/146 - (74%) Gaps:8/146 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69
            :::.|:.||:|||.|||||.||:||.:|||||||||||.....|||:|:.|:|.||:|.:.|.||
Mosquito   111 ISKNQMKEFREAFRLFDKDNDGSITKEELGTVMRSLGQFARVEELQEMLLEIDVDGDGNVSFEEF 175

  Fly    70 LTMMARKMKDT------DSEE-EIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIR 127
            :.:|: .|.||      |.|| |:|:|||||||...|:|:|::||.|:..|||.|.:||:::||:
Mosquito   176 VDIMS-NMTDTVAETSADQEERELRDAFRVFDKHNRGYITASDLRAVLQCLGEDLDEEEIEDMIK 239

  Fly   128 EADIDGDGQVNYEEFV 143
            |.|:||||::::.|||
Mosquito   240 EVDVDGDGRIDFYEFV 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 77/146 (53%)
AgaP_AGAP002536XP_312402.5 PTZ00184 111..255 CDD:185504 75/144 (52%)
EFh 118..180 CDD:238008 37/61 (61%)
EFh 197..258 CDD:238008 32/59 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.