DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calm1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001300863.1 Gene:Calm1 / 12313 MGIID:88251 Length:197 Species:Mus musculus


Alignment Length:148 Identity:145/148 - (97%)
Similarity:147/148 - (99%) Gaps:0/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 66
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Mouse    50 ADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDF 114

  Fly    67 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEVDEMIREADI 131
            |||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||||
Mouse   115 PEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADI 179

  Fly   132 DGDGQVNYEEFVTMMTSK 149
            ||||||||||||.|||:|
Mouse   180 DGDGQVNYEEFVQMMTAK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 144/146 (99%)
Calm1NP_001300863.1 PTZ00184 50..197 CDD:185504 144/146 (99%)
EFh 60..122 CDD:238008 61/61 (100%)
EFh 133..195 CDD:238008 59/61 (97%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5349
eggNOG 1 0.900 - - E33208_3BAEQ
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H116117
Inparanoid 1 1.050 292 1.000 Inparanoid score I2755
Isobase 1 0.950 - 0 Normalized mean entropy S63
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1386217at2759
OrthoFinder 1 1.000 - - FOG0000535
OrthoInspector 1 1.000 - - otm43873
orthoMCL 1 0.900 - - OOG6_100851
Panther 1 1.100 - - O PTHR23050
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X199
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.790

Return to query results.
Submit another query.