DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calb2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_031612.1 Gene:Calb2 / 12308 MGIID:101914 Length:271 Species:Mus musculus


Alignment Length:169 Identity:43/169 - (25%)
Similarity:78/169 - (46%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKEL------------GTVMRSLGQNPTEAELQDMINEVD 57
            |.|...::|.|.:..||.||:|.|..|||            |:.|.|...|..| ::::.:.:.|
Mouse    13 LAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSKSDNFGE-KMKEFMQKYD 76

  Fly    58 ADGNGTIDFPEFLTMMARK-------MKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGE 115
            .:.:|.|:..|...::..:       .:...|..|..||:|.:|.|.:|:|.|.||:..:::|.:
Mouse    77 KNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYDTDRSGYIEANELKGFLSDLLK 141

  Fly   116 KLT--------DEEVDEMIREADIDGDGQVNYEEFVTMM 146
            |..        .|....::|..|::|||::...|...::
Mouse   142 KANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 43/169 (25%)
Calb2NP_031612.1 EFh_HEF_CR 21..268 CDD:320077 41/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.