DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and Calb1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_033918.1 Gene:Calb1 / 12307 MGIID:88248 Length:261 Species:Mus musculus


Alignment Length:160 Identity:44/160 - (27%)
Similarity:74/160 - (46%) Gaps:26/160 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQ---DMINEVDADG---NGTIDFPE- 68
            ::|.|.:..||.||.|.:..|||..:::.|.|...:|.|:   :|.:.||..|   :|.|...| 
Mouse    14 SQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELSPEMKSFVDQYGQRDDGKIGIVEL 78

  Fly    69 ---------FLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTD----- 119
                     ||.:.  :.:...|.||..:.:|.:|.|.:|||...||::.:.:|.||...     
Mouse    79 AHVLPTEENFLLLF--RCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDT 141

  Fly   120 ---EEVDEMIREADIDGDGQVNYEEFVTMM 146
               |..|.|::..|.:.||::...|...::
Mouse   142 KLAEYTDLMLKLFDSNNDGKLELTEMARLL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 44/160 (28%)
Calb1NP_033918.1 Interaction with RANBP9. /evidence=ECO:0000250|UniProtKB:P05937 2..7
EFh_HEF 16..259 CDD:329015 44/158 (28%)
EF-hand motif 16..44 CDD:320075 10/27 (37%)
EF-hand motif 57..86 CDD:320075 7/28 (25%)
EF-hand motif 102..131 CDD:320075 9/28 (32%)
EF-hand motif 146..175 CDD:320075 6/26 (23%)
EF-hand motif 190..219 CDD:320075
EF-hand motif 234..259 CDD:320075
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.