DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and CAPN9

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_011542319.1 Gene:CAPN9 / 10753 HGNCID:1486 Length:721 Species:Homo sapiens


Alignment Length:155 Identity:39/155 - (25%)
Similarity:76/155 - (49%) Gaps:24/155 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DQLTEEQIAEFKEAFSLFDK--DGDGTITTKELGTVMRSLGQNPTEAEL--------QDMINEVD 57
            ||.|||: ..|:   :||::  ..|..:|.:||..|:.::.|...:.:.        :::|:.:|
Human   514 DQETEEE-QRFR---ALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMD 574

  Fly    58 ADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMTNLGEKLTDEEV 122
            ..|||.::|.||....       |..::....|..||.|.:|.:|..|||..:...|.:|:...:
Human   575 TSGNGKLEFDEFKVFW-------DKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLL 632

  Fly   123 DEMI-READIDGDGQVNYEEFVTMM 146
            ..:: |.|  |.:.|:::::|:..:
Human   633 QLIVLRYA--DEELQLDFDDFLNCL 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 39/155 (25%)
CAPN9XP_011542319.1 Peptidase_C2 43..335 CDD:279042
Calpain_III 349..491 CDD:279416
PTZ00184 514..657 CDD:185504 39/155 (25%)
EFh 566..621 CDD:238008 18/61 (30%)
EFh 600..652 CDD:298682 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.