DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and duox2

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_017947900.2 Gene:duox2 / 100486050 XenbaseID:XB-GENE-6047411 Length:1517 Species:Xenopus tropicalis


Alignment Length:167 Identity:41/167 - (24%)
Similarity:77/167 - (46%) Gaps:26/167 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQLTEEQIAEFKEAF---SL-----FDKDGDGTITTKELGTVMR----------SLGQNPTEA 47
            :.:..|::|..:..|.|   ||     .:|:..||...:....|::          |||.||...
 Frog   743 LKESFTKKQRQQMLETFIRHSLSHVIDINKEHAGTTQGQNFRDVLQCELSREEFADSLGLNPNAQ 807

  Fly    48 ELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAE------- 105
            .::.|.:..|.|.||.:.|.||..::...:|.: :|::::..|.:.|.:|||.:...|       
 Frog   808 FVESMFSMADKDHNGYLSFEEFCFILCSLIKGS-AEDKLKFIFSMHDVNGNGILPKEEFSRMLRS 871

  Fly   106 LRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEF 142
            .|:|.:.|..:.|:..::.|..||.|....::.:|:|
 Frog   872 FRNVSSFLSNEKTENVIESMFNEAGISNKKELAWEDF 908

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 41/167 (25%)
duox2XP_017947900.2 dual_peroxidase_like 29..581 CDD:188652
FRQ1 726..918 CDD:227455 41/167 (25%)
PLN02292 1056..>1376 CDD:215165
NOX_Duox_like_FAD_NADP 1244..1517 CDD:99783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.