DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and ocm1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_002931997.1 Gene:ocm1 / 100485867 XenbaseID:XB-GENE-488140 Length:113 Species:Xenopus tropicalis


Alignment Length:99 Identity:26/99 - (26%)
Similarity:46/99 - (46%) Gaps:8/99 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 AELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGFISAAELRHVMT 111
            |::...:.|..|.  .|.::.:|........|   |..|:::.|.|.|.|.:|::...||::::.
 Frog    10 ADIAAALRECQAP--DTFNYKKFFKTCGLTKK---SPNEVKQVFGVMDNDESGYVEEDELKYILQ 69

  Fly   112 NL---GEKLTDEEVDEMIREADIDGDGQVNYEEF 142
            ..   ...||..|..:.:...|.||||::..|||
 Frog    70 RFDPSARVLTSSEAKDFMAGVDHDGDGKIGVEEF 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 26/99 (26%)
ocm1XP_002931997.1 EFh_parvalbumin_beta 9..108 CDD:319998 26/99 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.