DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cam and caln1

DIOPT Version :9

Sequence 1:NP_001246276.1 Gene:Cam / 36329 FlyBaseID:FBgn0000253 Length:149 Species:Drosophila melanogaster
Sequence 2:XP_002935846.1 Gene:caln1 / 100379692 XenbaseID:XB-GENE-953326 Length:220 Species:Xenopus tropicalis


Alignment Length:147 Identity:48/147 - (32%)
Similarity:85/147 - (57%) Gaps:14/147 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEF 69
            ::.|::.|.:|||.:.|:||:|.|:.:|||..|||||..|:|.||..::..:|.||:|.:||.||
 Frog    34 ISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEF 98

  Fly    70 LTMMARKMKDTDSEE-----EIREAFRVFDKDGNGFISAAELRHVMTN-LGEKLTDEEVDEMI-- 126
            :|::..|:..|:..:     .|...|..||...   |:..||:|::.: ..:.||.::::.:|  
 Frog    99 VTILGPKLVSTEGRDGFLGNTIDSIFWQFDMQR---ITLEELKHILYHAFRDHLTMKDIENIIIN 160

  Fly   127 READID---GDGQVNYE 140
            .|..::   |:.|..:|
 Frog   161 EEESLNENSGNCQTEFE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CamNP_001246276.1 PTZ00184 1..149 CDD:185504 48/147 (33%)
caln1XP_002935846.1 PTZ00184 33..>143 CDD:185504 41/111 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.