DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha36-2 and Vha36-1

DIOPT Version :9

Sequence 1:NP_610753.1 Gene:Vha36-2 / 36328 FlyBaseID:FBgn0033706 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_651987.1 Gene:Vha36-1 / 44702 FlyBaseID:FBgn0022097 Length:246 Species:Drosophila melanogaster


Alignment Length:215 Identity:87/215 - (40%)
Similarity:129/215 - (60%) Gaps:2/215 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRDILPIFPSRANSVIMKQRVLAARRGVGLLKRKRDAIDMKLR-ELRRIRFDQDMHGDEAMRN 64
            |:.:|.|||||||...::||.|:..|::|.||||:|.||:.|:.| .|.:|...:.:.|| .|:.
  Fly     1 MSGKDRLPIFPSRGAQMLMKARLAGAQKGHGLLKKKADALQMRFRLILGKIIETKTLMGD-VMKE 64

  Fly    65 AIFSMAKANLLGADFKPQMVSRSHVATVSLRRTEIKIVGVKLNTLELETKGVGAFPLAGLSCGGM 129
            |.||:|:|.....|....::.....|.:.:|..:..:.||.|...|....|...:.||||:.||.
  Fly    65 AAFSLAEAKFTSGDINQVVLQNVTKAQIKIRTKKDNVAGVTLPVFESYQDGSDTYELAGLARGGQ 129

  Fly   130 QVSRIRDSYTKALKALVEFASLEYQVRMLEAASLQTNMRVNALEHVVIPILQNTYNYICGELEEF 194
            |:::::.:|..|:|.|||.|||:.....|:.....||.||||:|||:||.:..|..||..||:|.
  Fly   130 QLAKLKKNYQSAVKLLVELASLQTSFVTLDEVIKITNRRVNAIEHVIIPRIDRTLAYIISELDEL 194

  Fly   195 EREDFYRLKRSQAKQLEAKM 214
            |||:|||||:.|.|:.||::
  Fly   195 EREEFYRLKKIQDKKREARI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha36-2NP_610753.1 ATP-synt_D 18..206 CDD:280060 74/188 (39%)
PEHE <253..>294 CDD:291924
DUF4628 <281..>373 CDD:292069
Vha36-1NP_651987.1 ATP-synt_D 17..207 CDD:396399 74/190 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470076
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1394
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1313938at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101069
Panther 1 1.100 - - P PTHR11671
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.