DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha36-2 and atp6v1d

DIOPT Version :9

Sequence 1:NP_610753.1 Gene:Vha36-2 / 36328 FlyBaseID:FBgn0033706 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001161426.1 Gene:atp6v1d / 393935 ZFINID:ZDB-GENE-040426-727 Length:248 Species:Danio rerio


Alignment Length:258 Identity:97/258 - (37%)
Similarity:141/258 - (54%) Gaps:16/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKRDILPIFPSRANSVIMKQRVLAARRGVGLLKRKRDAIDMKLRE-LRRIRFDQDMHGDEAMRN 64
            |:.::.:.|||||....|||.|:..|:.|..|||:|.||:.|:.|: ||:|...:.:.| |.||.
Zfish     1 MSGKERIDIFPSRMAQTIMKARLKGAQTGRSLLKKKSDALSMRFRQILRKIIETKTLMG-EVMRE 64

  Fly    65 AIFSMAKANLLGADFKPQMVSRSHVATVSLRRTEIKIVGVKLNTLELETKGVGAFPLAGLSCGGM 129
            |.||:|:|.....||...::...:.|.|.:|..:..:.||.|...|...:|..::.|.||:.||.
Zfish    65 AAFSLAEAKFAAGDFSTTVIQNVNKAQVKVRAKKDNVAGVTLPVFEHYQEGGDSYELTGLARGGE 129

  Fly   130 QVSRIRDSYTKALKALVEFASLEYQVRMLEAASLQTNMRVNALEHVVIPILQNTYNYICGELEEF 194
            |:||::.:|.||::.|||.|||:.....|:.|...||.||||:|||:||.::.|..||..||:|.
Zfish   130 QLSRLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLTYIITELDER 194

  Fly   195 EREDFYRLKRSQAKQLEAKMAFTELIKTKNMTDEELETYIKRNINQTRPPAADTPFDQEQFEE 257
            |||:|||||:.|.|              |....|..|..|.:.:....|.|..|....|:.:|
Zfish   195 EREEFYRLKKIQEK--------------KKQLRERTEKEIAKRLAALGPIAEPTNMLTEEADE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha36-2NP_610753.1 ATP-synt_D 18..206 CDD:280060 80/188 (43%)
PEHE <253..>294 CDD:291924 2/5 (40%)
DUF4628 <281..>373 CDD:292069
atp6v1dNP_001161426.1 ATP-synt_D 17..206 CDD:280060 80/189 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1394
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1313938at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101069
Panther 1 1.100 - - O PTHR11671
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.