DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and MRPS17

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_013913.1 Gene:MRPS17 / 855226 SGDID:S000004800 Length:237 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:28/91 - (30%)
Similarity:46/91 - (50%) Gaps:6/91 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 RGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHC-SPVFRDVEHGDIVTIGECR 129
            |...|..||.:.|||:|:.:|.:...|.:|.::.....|:..||. ..:.|:   ||:|.|...|
Yeast     3 RQNFLGLVVSQGKMQKTVKVRVETKVFNKKINKELFHRRDYLVHDEGEISRE---GDLVRIEATR 64

  Fly   130 PLSKTVRFNVLKVSKGQGAKKSFKKY 155
            ||||...|.:.::.:.:|  :.|..|
Yeast    65 PLSKRKFFAIAEIIRNKG--QQFALY 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 27/89 (30%)
MRPS17NP_013913.1 RpsQ 1..83 CDD:223264 26/84 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100208
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.