DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and RPS11A

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_010308.3 Gene:RPS11A / 851589 SGDID:S000002432 Length:156 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:95/153 - (62%)
Similarity:117/153 - (76%) Gaps:5/153 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGDVRIRGR 68
            |:|||||||..:..|.|||   |.|:..|..::.|||||||:.||:|:|||||||:||.|.|||:
Yeast     8 QSERAFQKQPHIFNNPKVK---TSKRTKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSIRGK 69

  Fly    69 ILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSK 133
            ||||.|...||.|||||||.|||::.||:|:||||:|:.||.||.|| |:.|||||:|:|||:||
Yeast    70 ILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR-VQVGDIVTVGQCRPISK 133

  Fly   134 TVRFNVLKVSKGQG-AKKSFKKY 155
            ||||||:|||...| |.|.|.|:
Yeast   134 TVRFNVVKVSAAAGKANKQFAKF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 94/151 (62%)
RPS11ANP_010308.3 PTZ00241 4..156 CDD:240326 94/151 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345358
Domainoid 1 1.000 101 1.000 Domainoid score I1541
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88443
Inparanoid 1 1.050 182 1.000 Inparanoid score I950
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54030
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 1 1.000 - - otm46921
orthoMCL 1 0.900 - - OOG6_100208
Panther 1 1.100 - - LDO PTHR10744
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1229
SonicParanoid 1 1.000 - - X1342
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.