DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and EMB1080

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_190462.1 Gene:EMB1080 / 824054 AraportID:AT3G48930 Length:160 Species:Arabidopsis thaliana


Alignment Length:159 Identity:96/159 - (60%)
Similarity:114/159 - (71%) Gaps:10/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQNERAFQKQFGVNLNRK-----VKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWT 60
            ||:|.|:||.||..|.|:.|     .:||   |...|..:::|||||||||||||.|:|||||:|
plant     1 MAEQTEKAFLKQPKVFLSSKKSGKGKRPG---KGGNRFWKNIGLGFKTPREAIDGAYVDKKCPFT 62

  Fly    61 GDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTI 125
            |.|.||||||.|....|||||||::||||||||:||.|:||||.|:..|.||.|| |:.||.:.|
plant    63 GTVSIRGRILAGTCHSAKMQRTIIVRRDYLHFVKKYQRYEKRHSNIPAHVSPCFR-VKEGDHIII 126

  Fly   126 GECRPLSKTVRFNVLKVSKGQGAKKSFKK 154
            |:|||||||||||||||... |:..||.|
plant   127 GQCRPLSKTVRFNVLKVIPA-GSSSSFGK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 96/159 (60%)
EMB1080NP_190462.1 PTZ00241 1..155 CDD:240326 96/159 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 106 1.000 Domainoid score I2186
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88443
Inparanoid 1 1.050 177 1.000 Inparanoid score I1476
OMA 1 1.010 - - QHG54030
OrthoDB 1 1.010 - - D1325168at2759
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 1 1.000 - - otm3082
orthoMCL 1 0.900 - - OOG6_100208
Panther 1 1.100 - - O PTHR10744
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1342
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.