DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and RGD1563352

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:XP_575471.1 Gene:RGD1563352 / 500119 RGDID:1563352 Length:158 Species:Rattus norvegicus


Alignment Length:158 Identity:86/158 - (54%)
Similarity:118/158 - (74%) Gaps:3/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAD-QNERAFQKQFGVNLNRK-VKPGIT-KKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGD 62
            ||| ..|||:|.|..::.|:| |..|.| |:||.|..:::||||||.:||.:|||||||||:.|:
  Rat     1 MADTHTERAYQNQPTISQNKKHVLLGETGKEKLPRYHKNIGLGFKTTKEASEGTYIDKKCPFPGN 65

  Fly    63 VRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGE 127
            |.|:||:|..||:|.|:|||:.||:|.||::|||:||||:.:|..|..||.||.|:..||||:||
  Rat    66 VSIQGRMLFVVVKKMKLQRTVAIRQDCLHYIRKYNRFEKQPKNTPVRLSPCFRVVQINDIVTVGE 130

  Fly   128 CRPLSKTVRFNVLKVSKGQGAKKSFKKY 155
            ||||||||.:::.||:...|.:|.|:|:
  Rat   131 CRPLSKTVFYSMCKVTTAAGTRKQFQKF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 85/156 (54%)
RGD1563352XP_575471.1 PTZ00241 1..158 CDD:240326 85/156 (54%)
Ribosomal_S17_N 6..73 CDD:292822 36/66 (55%)
Ribosomal_S17 76..140 CDD:278780 40/63 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349356
Domainoid 1 1.000 81 1.000 Domainoid score I8297
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3470
OMA 1 1.010 - - QHG54030
OrthoDB 1 1.010 - - D1325168at2759
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 1 1.000 - - otm46069
orthoMCL 1 0.900 - - OOG6_100208
Panther 1 1.100 - - O PTHR10744
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1342
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.