DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and Rps11

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_038753.1 Gene:Rps11 / 27207 MGIID:1351329 Length:158 Species:Mus musculus


Alignment Length:158 Identity:113/158 - (71%)
Similarity:134/158 - (84%) Gaps:3/158 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAD-QNERAFQKQFGVNLNRK-VKPGIT-KKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGD 62
            ||| |.|||:|||..:..|:| |..|.| |:||.|..:::|||||||:|||:|||||||||:||:
Mouse     1 MADIQTERAYQKQPTIFQNKKRVLLGETGKEKLPRYYKNIGLGFKTPKEAIEGTYIDKKCPFTGN 65

  Fly    63 VRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGE 127
            |.||||||:|||.|.||||||||||||||::|||:||||||:|||||.||.||||:.|||||:||
Mouse    66 VSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLSPCFRDVQIGDIVTVGE 130

  Fly   128 CRPLSKTVRFNVLKVSKGQGAKKSFKKY 155
            |||||||||||||||:|..|.||.|:|:
Mouse   131 CRPLSKTVRFNVLKVTKAAGTKKQFQKF 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 112/156 (72%)
Rps11NP_038753.1 PTZ00241 1..158 CDD:240326 112/156 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845925
Domainoid 1 1.000 127 1.000 Domainoid score I5368
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88443
Inparanoid 1 1.050 220 1.000 Inparanoid score I3554
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54030
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 1 1.000 - - oto94684
orthoMCL 1 0.900 - - OOG6_100208
Panther 1 1.100 - - LDO PTHR10744
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1229
SonicParanoid 1 1.000 - - X1342
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.