DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and rps1102

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_594672.1 Gene:rps1102 / 2542904 PomBaseID:SPAC144.11 Length:152 Species:Schizosaccharomyces pombe


Alignment Length:152 Identity:90/152 - (59%)
Similarity:109/152 - (71%) Gaps:7/152 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGDVRIRGR 68
            |:|||||||..:..|.|...|      .|..:|||||||||.|||.|.|:|||||:.|.|.||||
pombe     8 QSERAFQKQPHIFQNAKKGAG------RRWYKDVGLGFKTPAEAIYGEYVDKKCPFVGQVSIRGR 66

  Fly    69 ILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRPLSK 133
            ||||.|...||.|||:|||:||||:.||:|:||||:|::.|.||.|| :..||:||:|:||||||
pombe    67 ILTGTVVSTKMHRTIIIRREYLHFIPKYNRYEKRHKNLAAHVSPAFR-INEGDVVTVGQCRPLSK 130

  Fly   134 TVRFNVLKVSKGQGAKKSFKKY 155
            |||||||:|.|.....|.|.|:
pombe   131 TVRFNVLRVVKHTEGPKQFGKF 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 89/150 (59%)
rps1102NP_594672.1 PTZ00241 7..152 CDD:240326 89/150 (59%)
Ribosomal_S17_N 8..68 CDD:292822 37/65 (57%)
RpsQ 59..142 CDD:223264 55/83 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I1757
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88443
Inparanoid 1 1.050 178 1.000 Inparanoid score I1137
OMA 1 1.010 - - QHG54030
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 1 1.000 - - otm47367
orthoMCL 1 0.900 - - OOG6_100208
Panther 1 1.100 - - LDO PTHR10744
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1342
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.