DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and mrps17

DIOPT Version :10

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_595464.1 Gene:mrps17 / 2540774 PomBaseID:SPBC409.14C Length:90 Species:Schizosaccharomyces pombe


Alignment Length:93 Identity:25/93 - (26%)
Similarity:38/93 - (40%) Gaps:25/93 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GTYIDKKCPWTGDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVF 114
            |..|.:..|.|..||:.......||:|               :|.:|..:..:.   .::|:.  
pombe     7 GIVISRAMPKTAKVRVAKEKFHPVVKK---------------YVTQYQNYMVQD---DLNCNV-- 51

  Fly   115 RDVEHGDIVTIGECRPLSKTVRFNVLKV 142
                 ||.|||..|||.|.|.||.::|:
pombe    52 -----GDAVTIQPCRPRSATKRFEIIKI 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 25/93 (27%)
mrps17NP_595464.1 Ribosomal_uS17 6..74 CDD:466775 24/91 (26%)

Return to query results.
Submit another query.