DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS11 and rps-11

DIOPT Version :9

Sequence 1:NP_725114.1 Gene:RpS11 / 36321 FlyBaseID:FBgn0033699 Length:155 Species:Drosophila melanogaster
Sequence 2:NP_502186.1 Gene:rps-11 / 178083 WormBaseID:WBGene00004480 Length:155 Species:Caenorhabditis elegans


Alignment Length:155 Identity:102/155 - (65%)
Similarity:122/155 - (78%) Gaps:0/155 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWTGDVRI 65
            |::|.||||.||..||||.|.:.....||..|..|:||||||.||:|::||||||||||.|:|.|
 Worm     1 MSEQTERAFLKQPTVNLNNKARILAGSKKTPRYIREVGLGFKAPRDAVEGTYIDKKCPWAGNVPI 65

  Fly    66 RGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHGDIVTIGECRP 130
            ||.||||||.|.||.||||:||||||:::||.|:||||:|:..||||.|||:..||:||||||||
 Worm    66 RGMILTGVVLKNKMTRTIVVRRDYLHYIKKYRRYEKRHKNVPAHCSPAFRDIHPGDLVTIGECRP 130

  Fly   131 LSKTVRFNVLKVSKGQGAKKSFKKY 155
            ||||||||||||:|...:||.|.|:
 Worm   131 LSKTVRFNVLKVNKSGTSKKGFSKF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS11NP_725114.1 PTZ00241 1..155 CDD:240326 101/153 (66%)
rps-11NP_502186.1 PTZ00241 1..155 CDD:240326 101/153 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164047
Domainoid 1 1.000 118 1.000 Domainoid score I3654
eggNOG 1 0.900 - - E1_COG0186
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H88443
Inparanoid 1 1.050 215 1.000 Inparanoid score I2333
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54030
OrthoDB 1 1.010 - - D1325168at2759
OrthoFinder 1 1.000 - - FOG0000911
OrthoInspector 1 1.000 - - oto17202
orthoMCL 1 0.900 - - OOG6_100208
Panther 1 1.100 - - LDO PTHR10744
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1229
SonicParanoid 1 1.000 - - X1342
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.