DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and ERG11

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_011871.1 Gene:ERG11 / 856398 SGDID:S000001049 Length:530 Species:Saccharomyces cerevisiae


Alignment Length:421 Identity:89/421 - (21%)
Similarity:146/421 - (34%) Gaps:125/421 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RKLGDRLERVLPLGRMCQLY-------------TTDVTGNLFYS-LNVGGLRRG------RSELI 209
            :|.||....|| |||:..:|             ..||:....|: |......:|      .|.|:
Yeast    85 KKYGDIFSFVL-LGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLM 148

  Fly   210 TK--------TKELFNTNPRKVLDFMSVFFL--------PKWTG-----VLKPK--VFTED---Y 248
            .:        |||.|.:....:.:.:..:|.        .:.||     |.:|:  :||..   .
Yeast   149 EQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLL 213

  Fly   249 ARYMRHLVDDHHEPTKGDL------IN------QLQHFQ-----------------LSRSSNHYS 284
            .:.||..:|........||      ||      .|:|::                 ..|..|:..
Yeast   214 GKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDI 278

  Fly   285 QHPDFVAS-------QAGI-------------ILLAGFETSSALMGFTLYELAKAPDIQERLRSE 329
            |..|.:.|       :.|:             :|:.|..||:|...:.|..||:.||:|:.|..|
Yeast   279 QDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEE 343

  Fly   330 -LREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPG 393
             :|........|:||.|..:|.|.....|.||::.....:.|:......     .|:..:::|.|
Yeast   344 QMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMH-----VPNTSYVIPAG 403

  Fly   394 MPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIH----------------PMTYIPFGAGPH 442
            ....:|....|..:.::|....|:..|:..:.:....                ...|:|||.|.|
Yeast   404 YHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRH 468

  Fly   443 GCIGSRLGVLQLKLGI-----VHILKQYWVE 468
            .|||......|  ||:     :..||.::.|
Yeast   469 RCIGEHFAYCQ--LGVLMSIFIRTLKWHYPE 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 89/421 (21%)
ERG11NP_011871.1 CYP51-like 83..521 CDD:410668 89/421 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 103 1.000 Domainoid score I1492
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1477
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.