DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP4F2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001073.3 Gene:CYP4F2 / 8529 HGNCID:2645 Length:520 Species:Homo sapiens


Alignment Length:562 Identity:134/562 - (23%)
Similarity:229/562 - (40%) Gaps:136/562 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVTLNFWLRH----KYDYF----RSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQL 61
            ||||| :|..::.|.|    .|.::    |.|..|..|..:|. .|:.|.:              
Human    19 WLLLL-LVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWF-WGHQGMV-------------- 67

  Fly    62 YADPRNGQAKIV---------GFFIFQ---TPALMVRDPELIRQVL-----IKNFNNFLNRFESA 109
              :|.....:::         ||.::.   :|.|.:..|::||.|:     |...:.|...|...
Human    68 --NPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEP 130

  Fly   110 DAGDPMGALTLPLAKYHHWKESRQCMSQLFTSGRMR----------DVMYSQMLDVASDLEQYLN 164
            ..||  |.|   |:....|...|:.::..|....::          ::|:::...:||:....| 
Human   131 WLGD--GLL---LSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACL- 189

  Fly   165 RKLGDRLERVLPLGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKE---LFNTNPRKVL-- 224
                |..|.:       .|.|.|......:|.: ...:...||.|....|   |.:....::|  
Human   190 ----DMFEHI-------SLMTLDSLQKCVFSFD-SHCQEKPSEYIAAILELSALVSKRHHEILLH 242

  Fly   225 -DFMSVFFLPKWTGVLKPKVFTEDYARYMR--HLVDDHHE----------PTKG----------- 265
             ||:  ::|            |.|..|:.|  .||.|..:          |::|           
Human   243 IDFL--YYL------------TPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKS 293

  Fly   266 ---DLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLR 327
               |.|:.|   .||:..:......:.:.::|...:..|.:|:::.:.:.||.|||.|:.|||.|
Human   294 KTLDFIDVL---LLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCR 355

  Fly   328 SELREAF--ISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSS--ASEGFSLQPHVDF 388
            .|::|..  .....:.:|.|..||:|.|...|:|||:|....::|..|..  ..:|        .
Human   356 QEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDG--------R 412

  Fly   389 IVPPGMPAYISILGLHRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQ 453
            ::|.|:...||:.|.|.:...||:|.|:||.||.||..:...|:.:|||.|||..|||....:.:
Human   413 VIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAE 477

  Fly   454 LKLGIVHILKQYWVETCERTVSEIRFNPKSFMLESENEIYLR 495
            :|:.:...|.::.|....   :|.|..|: .:|.:|..::||
Human   478 MKVVLALTLLRFRVLPDH---TEPRRKPE-LVLRAEGGLWLR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 118/514 (23%)
CYP4F2NP_001073.3 DUF4175 4..>57 CDD:372724 13/38 (34%)
p450 52..515 CDD:365848 121/526 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.