powered by:
Protein Alignment Cyp6t3 and CYP96A14P
DIOPT Version :9
Sequence 1: | NP_610745.1 |
Gene: | Cyp6t3 / 36318 |
FlyBaseID: | FBgn0033697 |
Length: | 501 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_176777.1 |
Gene: | CYP96A14P / 842916 |
AraportID: | AT1G66030 |
Length: | 167 |
Species: | Arabidopsis thaliana |
Alignment Length: | 57 |
Identity: | 13/57 - (22%) |
Similarity: | 22/57 - (38%) |
Gaps: | 10/57 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 419 ERFGP----------ERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY 465
|.||| |..|::...|.:.|....:....:.....:||||:|.:...:
plant 107 EIFGPFGDGIINSDSELWRNLKKATQVIFNHQKYQKFSTSTTRSKLKLGLVPLFNDH 163
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Cyp6t3 | NP_610745.1 |
p450 |
34..486 |
CDD:299894 |
13/57 (23%) |
CYP96A14P | NP_176777.1 |
p450 |
1..>166 |
CDD:386267 |
13/57 (23%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1247045at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.