DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP96A3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_176713.1 Gene:CYP96A3 / 842842 AraportID:AT1G65340 Length:503 Species:Arabidopsis thaliana


Alignment Length:457 Identity:102/457 - (22%)
Similarity:171/457 - (37%) Gaps:107/457 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FIFQTPA------LMVRDPELIRQVLIKNFNNFLNRFESAD----AGDPMGALTLPLAKYHHWKE 130
            |.|:.|.      |:..||..|..:|..||.|:....|...    .||.:..:...|     |::
plant    68 FCFKGPCLSGMDILLTVDPVNIHYILSSNFANYPKGMEFKKIFEVVGDSIFNVDSGL-----WED 127

  Fly   131 SRQCMSQLFTS------------GRMRDVMYSQMLDVAS-----DLEQYLNRKLGDRLERVLPLG 178
            .|.....:|::            .::|..:...:.:.|.     ||:....|.|.| ...:|..|
plant   128 MRNSSHAIFSNQDFQMFWVSTSVRKLRQGLVPILENAADKNILVDLQDLFQRFLFD-TSLILMTG 191

  Fly   179 --------RMCQLYTTD----VTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLD-FMSVF 230
                    .|.::...|    |:..:||       |..:...:.:.:.|......|.|. .::||
plant   192 YDPKCLSVEMPKVEFGDAVDGVSDGVFY-------RHVKPVFLWRLQYLIGVGVEKRLKRGLAVF 249

  Fly   231 FLPKWTGVLKPKVFTEDYARYMRHLVDDH--HEPTKGDLINQLQHFQLSRSSNHYSQHPD---FV 290
                  ..|..|:.|.     .|..::.|  |.|::|:.|:.|.::....::.:....|.   |:
plant   250 ------DQLLEKIITA-----KREEINSHGTHHPSRGEAIDVLTYYMTMDTTKYKYLEPSDDRFI 303

  Fly   291 ASQ-AGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYD--TLMTLPYLK 352
            ... .|.::.|...|||||..| .:.::|.|:...::|.|     ::.....:|  .|..|.||.
plant   304 KDTILGFLIAARDTTSSALTWF-FWLMSKNPEAINKIRQE-----VNKKMPRFDPADLEKLVYLH 362

  Fly   353 MVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPG------MPAYISILGLHRDERFWP 411
            ....|.|||||...|.::            .|....::|.|      ....||:..|.|.:..|.
plant   363 GAVCETLRLYPPVPFNHK------------SPAKPDVLPSGHRVDEKWKIVISMYALGRMKSVWG 415

  Fly   412 EPCVFDPERFGPE-------RSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVET 469
            :    |.|.|.||       |.:|.....::.|.|||..|:|.:|..||:|.....|::.|.::.
plant   416 D----DAEDFRPERWISDSGRLKHEPSYKFLAFNAGPRACLGKKLTFLQMKTVAAEIIRNYDIKV 476

  Fly   470 CE 471
            .|
plant   477 VE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 102/457 (22%)
CYP96A3NP_176713.1 p450 22..502 CDD:386267 102/457 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.