DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP86A7

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_176558.1 Gene:CYP86A7 / 842675 AraportID:AT1G63710 Length:523 Species:Arabidopsis thaliana


Alignment Length:523 Identity:116/523 - (22%)
Similarity:203/523 - (38%) Gaps:117/523 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLLTIVTLNFW---LRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPRN 67
            ::|..|||...|   ||..|     :|     |..|..:|:|..|    |:.........||...
plant     8 IILTLIVTYIIWFVSLRRSY-----KG-----PRVWPLVGSLPAL----ITNAHRMHDFIADNLR 58

  Fly    68 GQAKIVGFFIFQTPALMVR--------DPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAK 124
            .........||..|.|..:        ||:.:..:|...|:|:           |.|.....:  
plant    59 MCGGTYQTCIFPIPFLAKKQGHVTVTCDPKNLEHILKTRFDNY-----------PKGPSWQSV-- 110

  Fly   125 YHH-------------WKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLP 176
            :|.             |:..|:..:..||:..:|..|           .::::|.:.:||..:|.
plant   111 FHDLLGDGIFNSDGDTWRFQRKTAALEFTTRTLRQAM-----------ARWVDRAIKNRLVPILE 164

  Fly   177 LGRMC--QLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLD-----FMSVFFLPK 234
            ..|..  .:...||...|.:. |:.||..|:... |.:.|..........|     .:..|.:|:
plant   165 SARSRAEPIDLQDVLLRLTFD-NICGLTFGKDPR-TLSPEFPENGFAVAFDGATEATLQRFIMPE 227

  Fly   235 WTGVLKPKV---FTEDYARYMRHLVDDH-----------------HEPTKGDLINQLQHFQLSRS 279
            :...::..:   ..:|.:|.:.| ||::                 .|....||:::.    :.:.
plant   228 FIWKIRKWLRLGLEDDMSRSISH-VDNYLSEIINTRKLELLGQQQDESRHDDLLSRF----MKKK 287

  Fly   280 SNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSEL-------REAFIST 337
            .::..::..:||..   .:|||.:|||..|.:..:.::..|.::|::.:|:       |:..:|.
plant   288 ESYSDKYLKYVALN---FILAGRDTSSVAMSWFFWLVSLNPRVEEKIINEICTILIKTRDTNVSK 349

  Fly   338 AT---LSYDTLMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYIS 399
            .|   |::|.:..|.|||....|.|||||:....::...::     .:.|...| ||.|.....|
plant   350 WTDEPLTFDEIDQLVYLKAALSETLRLYPSVPEDSKFVVAN-----DVLPDGTF-VPSGSNVTYS 408

  Fly   400 ILGLHRDERFWPEPCV-FDPERFGPE-RSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHIL 462
            |..:.|.:..|.|.|: |.|||:..| |....:...::.|.|||..|:|..|..||:|.....||
plant   409 IYSVGRMKFIWGEDCLEFKPERWLEESRDEKCNQYKFVAFNAGPRICLGKDLAYLQMKSITASIL 473

  Fly   463 KQY 465
            .::
plant   474 LRH 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 107/492 (22%)
CYP86A7NP_176558.1 PLN03195 4..507 CDD:215627 116/523 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.