DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP97A3

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_564384.1 Gene:CYP97A3 / 840067 AraportID:AT1G31800 Length:595 Species:Arabidopsis thaliana


Alignment Length:489 Identity:105/489 - (21%)
Similarity:187/489 - (38%) Gaps:94/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLF-----LRISFGDLFRQLYADPRNGQAKIVGFF 76
            |.....||      |.:|.:..|......:..|     |.:::|.:||..:. |::         
plant   103 WTGSDQDY------PKVPEAKGSIQAVRNEAFFIPLYELFLTYGGIFRLTFG-PKS--------- 151

  Fly    77 IFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLAKYHHWKESRQ-------- 133
                 .|:|.||.:.:.:|..|...:.....:......||...:| |....|:..|:        
plant   152 -----FLIVSDPSIAKHILKDNAKAYSKGILAEILDFVMGKGLIP-ADGEIWRRRRRAIVPALHQ 210

  Fly   134 ----CMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLYTTDVTGNLFY 194
                .|..||  |...|.: .|.||.|:        ..|:.:|......|:    |.|:.|...:
plant   211 KYVAAMISLF--GEASDRL-CQKLDAAA--------LKGEEVEMESLFSRL----TLDIIGKAVF 260

  Fly   195 SLNVGGLRRGRSEL-----ITKTKELFNTNPRKVLDFMSVFFLPKWTGV--LKPKVFT------- 245
            :.:...|......:     :.:..|..:.:|..|.|      :|.|..:  .:.||.|       
plant   261 NYDFDSLTNDTGVIEAVYTVLREAEDRSVSPIPVWD------IPIWKDISPRQRKVATSLKLIND 319

  Fly   246 --EDYARYMRHLVDDH----HEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAGIILLAGFET 304
              :|.....:.:|::.    ||....:....:.||.|:...:..|:.   :......:|:||.||
plant   320 TLDDLIATCKRMVEEEELQFHEEYMNERDPSILHFLLASGDDVSSKQ---LRDDLMTMLIAGHET 381

  Fly   305 SSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYLKMVCLEALRLYPAAAFVN 369
            |:|::.:|.|.|...|.:..:|:.|: ::.|.....:...:..|.|...|..|:|||||....:.
plant   382 SAAVLTWTFYLLTTEPSVVAKLQEEV-DSVIGDRFPTIQDMKKLKYTTRVMNESLRLYPQPPVLI 445

  Fly   370 RECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFDPERF---GPERSRHIHP 431
            |....:...|       ::.:..|...:||:..|||....|.:...|:|||:   ||..:.....
plant   446 RRSIDNDILG-------EYPIKRGEDIFISVWNLHRSPLHWDDAEKFNPERWPLDGPNPNETNQN 503

  Fly   432 MTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY 465
            .:|:|||.||..|||......:..:.|..:::::
plant   504 FSYLPFGGGPRKCIGDMFASFENVVAIAMLIRRF 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 101/472 (21%)
CYP97A3NP_564384.1 PLN02738 1..595 CDD:215393 105/489 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.