DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP87A2

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001184974.1 Gene:CYP87A2 / 837830 AraportID:AT1G12740 Length:478 Species:Arabidopsis thaliana


Alignment Length:518 Identity:97/518 - (18%)
Similarity:186/518 - (35%) Gaps:121/518 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADPR 66
            ||||:.|| ::::..|:   |.:...:....|||      |::|                  .|.
plant     4 LLIWVSLL-LISITHWV---YSWRNPKCRGKLPP------GSMG------------------FPL 40

  Fly    67 NGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNR---FESADAGDPMGALTLPLAKYHHW 128
            .|::  :.||   .|......|..|:: .:||..:....   |::...|.|:...|.....|..:
plant    41 LGES--IQFF---KPNKTSDIPPFIKE-RVKNDVDMCRYGPIFKTNLVGRPVIVSTDADLSYFVF 99

  Fly   129 KESRQCMSQLFTS-----------GRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLP-----L 177
            .:..:|....:..           |.:...||..:.::...|..:      |.|:::||     .
plant   100 NQEGRCFQSWYPDTFTHIFGKKNVGSLHGFMYKYLKNMVLTLFGH------DGLKKMLPQVEMTA 158

  Fly   178 GRMCQLYTT-------DVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFMSVFFLPKW 235
            .:..:|::.       |.|.::.:.|.              .|:|.:.:|.|..:.:...|:...
plant   159 NKRLELWSNQDSVELKDATASMIFDLT--------------AKKLISHDPDKSSENLRANFVAFI 209

  Fly   236 TGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQAG----- 295
            .|::.   |..|......|............|.|.||..:.:...|. |...|:|..:..     
plant   210 QGLIS---FPFDIPGTAYHKCLQGRAKAMKMLRNMLQERRENPRKNP-SDFFDYVIEEIQKEGTI 270

  Fly   296 -----------IILLAGFETSSALMGFTLYELAKAPDIQERLRSE----LREAFISTATLSYDTL 345
                       ::|.|.|||:|..:...:..|:..|::.:||..|    ||....:.:.|:::..
plant   271 LTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDPEVLKRLTEEHETILRNREDADSGLTWEEY 335

  Fly   346 MTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFW 410
            .::.|......|..||......:.|:......       ..|:.:|.|....:....:|.:...:
plant   336 KSMTYTFQFINETARLANIVPAIFRKALRDIK-------FKDYTIPAGWAVMVCPPAVHLNPEMY 393

  Fly   411 PEPCVFDPERFGPER----SRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY-WVE 468
            .:|.||:|.|:...:    |:|     ::.||.|...|:|:....||:...:..::.:| |.|
plant   394 KDPLVFNPSRWEGSKVTNASKH-----FMAFGGGMRFCVGTDFTKLQMAAFLHSLVTKYRWEE 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 88/486 (18%)
CYP87A2NP_001184974.1 p450 4..475 CDD:299894 97/518 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.