DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP71A18

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_001184964.1 Gene:CYP71A18 / 837705 AraportID:AT1G11610 Length:504 Species:Arabidopsis thaliana


Alignment Length:505 Identity:113/505 - (22%)
Similarity:196/505 - (38%) Gaps:103/505 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSW--SPMGNLGQLLF--------LRISFGD 56
            |::.|.|.|::||   |..|....|:....:||||.|  ..:|||.||..        |.:.:|.
plant     5 LMVSLCLTTLLTL---LLLKKFLKRTAKKVNLPPSPWRIPVIGNLHQLSLHPHRSLHSLSLRYGP 66

  Fly    57 LFRQLYADPRNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFES-ADAGDPMGALTL 120
            |....:.               :.|.|:|...|...::|..:...|.||.:| |..|...|...:
plant    67 LMLLHFG---------------RVPILVVSSSEAAHEILKTHDLKFANRPKSKAVHGLMNGGRDV 116

  Fly   121 PLAKY-HHWKESRQ-CMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQL 183
            ....| .:|::.:. |:..|.|:..:......:..:|.:.:|:..........|.   |..:...
plant   117 VFGPYGEYWRQMKSVCILNLLTNKMVASFEKVREEEVNAMMEKLEKASCSSSAEN---LSELFVT 178

  Fly   184 YTTDVTGNLFYSL--------NVGGLRRGRSELITKTKELFNTNPRKVLDFMSVF----FLPKWT 236
            .|:|||..:  ||        ..|||::               ..|::::.:..|    ::|...
plant   179 LTSDVTSRV--SLGKKYWEDETAGGLKK---------------RVRQIMELLREFPIGDYVPALA 226

  Fly   237 GVLKPKVF-------TEDYARYMRHLVDDHHE--PTKGDLINQLQHFQLSRSSNHYSQHPD--FV 290
            .:.:...|       :..|:..|..:|.:|.|  ..|.|.:|.|...:..:::....|..|  |:
plant   227 WIDRINGFNSKIVEVSRAYSDLMEKVVQEHLEAGEHKADFVNILLSIEKEKNNGFKVQRNDIKFM 291

  Fly   291 ASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTAT-LSYDTLMTLPYLKMV 354
            ...   :.:.|..|||.|:.:.:.||.:.|:..::|::|:|.......: :....:..:.|||.|
plant   292 ILD---MFIGGISTSSTLLEWIMTELIRNPECMKKLQNEIRSTIRPHGSYIKEKEVENMRYLKAV 353

  Fly   355 CLEALRLYPAAAFV-NRECTSSAS-EGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFD 417
            ..|..|::|....: .|..|.... :|:.        :..|....|:...:|||...|..    |
plant   354 IKEVFRVHPPLPLILPRLLTEDVKVKGYD--------IAAGTEVLINAWSIHRDPAIWGP----D 406

  Fly   418 PERFGPER------SRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHI 461
            .|.|.|||      ..|...:.|||||:|...|.|     :.|.:|:|.:
plant   407 AEEFKPERHLDSTLDYHGQDLKYIPFGSGRRICPG-----INLAMGLVEV 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 103/473 (22%)
CYP71A18NP_001184964.1 p450 26..496 CDD:299894 105/481 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.