DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP86A1

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200694.1 Gene:CYP86A1 / 836003 AraportID:AT5G58860 Length:513 Species:Arabidopsis thaliana


Alignment Length:453 Identity:108/453 - (23%)
Similarity:161/453 - (35%) Gaps:106/453 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPL--AKYHH----- 127
            ||..||:      .:...|:.:..:|...|:|:           |.|    |:  |.:|.     
plant    78 AKAQGFY------TVTCHPKNVEHILKTRFDNY-----------PKG----PMWRAAFHDLLGQG 121

  Fly   128 --------WKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLERVLPLGRMCQLY 184
                    |...|:..:..||:..:|..|           .:::|..:.:||  .|.|.|..|..
plant   122 IFNSDGDTWLMQRKTAALEFTTRTLRQAM-----------ARWVNGTIKNRL--WLILDRAVQNN 173

  Fly   185 TTDVTGNLFYSL---NVGGLRRGRSELITKTKEL-FNTNPRKV-LDFMSVFFLPK--WTGVL--- 239
            ......:||..|   |:.||..|:.   .:|..| ...||..| .|..:...|.:  :||.|   
plant   174 KPVDLQDLFLRLTFDNICGLTFGKD---PETLSLDLPDNPFSVAFDTATEATLKRLLYTGFLWRI 235

  Fly   240 ----------KPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHPDFVASQA 294
                      |.|...|....||...:|........||   |..|...|..|......|.:...|
plant   236 QKAMGIGSEDKLKKSLEVVETYMNDAIDARKNSPSDDL---LSRFLKKRDVNGNVLPTDVLQRIA 297

  Fly   295 GIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFIST----------ATLSYDTLMTLP 349
            ...:|||.:|||..:.:..:.:....:::.::.:||......|          ..|.:|....|.
plant   298 LNFVLAGRDTSSVALSWFFWLVMNNREVETKIVNELSMVLKETRGNDQEKWTEEPLEFDEADRLV 362

  Fly   350 YLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFI-----VPPGMPAYISILGLHRDERF 409
            |||....|.|||||           |..:.|......|.:     ||.|.....||..:.|.:..
plant   363 YLKAALAETLRLYP-----------SVPQDFKYVVDDDVLPDGTFVPRGSTVTYSIYSIGRMKTI 416

  Fly   410 WPEPCV-FDPERF-GPERSRHIHP---MTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWV 467
            |.|.|: |.|||: ..:..|...|   ..::.|.|||..|:|..|...|:|.....:|.:|.|
plant   417 WGEDCLEFRPERWLTADGERFETPKDGYKFVAFNAGPRTCLGKDLAYNQMKSVASAVLLRYRV 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 108/453 (24%)
CYP86A1NP_200694.1 CYP86A 70..501 CDD:410687 108/453 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.