DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CYP96A4

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_200045.1 Gene:CYP96A4 / 835308 AraportID:AT5G52320 Length:502 Species:Arabidopsis thaliana


Alignment Length:523 Identity:118/523 - (22%)
Similarity:204/523 - (39%) Gaps:101/523 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLIWLLLLTIVTLNFWLRHKYDYFR-SRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQLYADP 65
            ::|.||.:.|..:.|::   |..|. .:..|.....:|..:|.|..:||......|...:. .:.
plant     3 MIIGLLEIFIAFIFFFV---YQCFSLHKKTPKHMVMNWPVLGMLPGVLFQIPRIYDFVTEA-LEA 63

  Fly    66 RNGQAKIVGFFIFQTPALMVRDPELIRQVLIKNFNNF-----LNR-FE-------SADAGDPMGA 117
            .|.....:|.::..|..|:..||..|:.:|..||.|:     .|: ||       :.|:|     
plant    64 ENMTGCFIGPWLSGTDILLTVDPVNIQYILSSNFVNYPKGKKFNKIFEFLGDGIFNVDSG----- 123

  Fly   118 LTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNRKLGDRLER--VLPLGRM 180
                     .|::.|.....:|:.   :|.....:....|.|.|.|...|.:.:|:  ::.|..:
plant   124 ---------LWEDMRNSSHAIFSH---QDFQSFSVSTSVSKLSQGLVPILDNAVEKHILVDLQDL 176

  Fly   181 CQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKELFNTNPRKVLDFM--------SVFFLPKWTG 237
            .|.:..|.:..|....:      .:|..:...|..|......|.|.|        .::.:..|.|
plant   177 FQRFLFDTSSTLMAGYD------PKSLSVEMPKVEFADAMDGVADAMFYRHLKPAFLWSIQSWIG 235

  Fly   238 V-LKPK------VFTEDYARYM---RHLVDDH--HEPTKGDLINQLQHFQLSRSSNHYSQHPD-- 288
            | ::.|      ||.:...:.:   |..:.:|  |: :||:.::.|.::....::.:....|.  
plant   236 VGIEKKMRRGLDVFDQMLGKIISAKREEIKNHGIHD-SKGEAMDVLTYYMTIDTTKYKHLKPSND 299

  Fly   289 -FVASQ-AGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDTLMTLPYL 351
             |:... .|:::.|...|||||..| .:.|:|.|:...::|.|:.:..........|.|:   ||
plant   300 KFIRDTILGLVIAARDTTSSALTWF-FWLLSKNPEAMTKIRQEINKKMPKFDPADLDKLV---YL 360

  Fly   352 KMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHVDFIVPPG------MPAYISILGLHRDERFW 410
            .....|.|||||:..|.::            .|....::|.|      ....|.|..|.|.:..|
plant   361 DGAVCETLRLYPSVPFNHK------------SPAKPDVLPSGHKVDKNWRVVIPIYSLGRMKSVW 413

  Fly   411 PEPCVFDPERFGPER-------SRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWVE 468
            .:    |.|.|.|||       .|......::.|.|||..|:|.||..||:|...|.|::.|.::
plant   414 GD----DAEDFRPERWISDSGMLRQESSYKFLAFNAGPRTCLGKRLTFLQMKTVAVEIIRNYDIK 474

  Fly   469 TCE 471
            ..|
plant   475 VVE 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 110/490 (22%)
CYP96A4NP_200045.1 p450 1..501 CDD:416425 118/523 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.