DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp6t3 and CPD

DIOPT Version :9

Sequence 1:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster
Sequence 2:NP_196188.1 Gene:CPD / 830453 AraportID:AT5G05690 Length:472 Species:Arabidopsis thaliana


Alignment Length:513 Identity:111/513 - (21%)
Similarity:191/513 - (37%) Gaps:126/513 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WLLLLTIVTLNFWLRHKYDYFRSRGIPHLPPSSWSPMGNLGQLLFLRISFGDLFRQL-------- 61
            :||||:.:...|.|..:...:|..|   |||      |:||..|     .|:.|:.:        
plant     6 FLLLLSSIAAGFLLLLRRTRYRRMG---LPP------GSLGLPL-----IGETFQLIGAYKTENP 56

  Fly    62 --YADPRNGQ-AKIVGFFIFQTPALMVRDPELIRQVLIKNFNNFLNRFESADAGDPMGALTLPLA 123
              :.|.|..: ..:....:|..|.:...|||..|.||       .|..:..:...|.....| |.
plant    57 EPFIDERVARYGSVFMTHLFGEPTIFSADPETNRFVL-------QNEGKLFECSYPASICNL-LG 113

  Fly   124 KYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVAS----------DLEQYLNRKLGDRLERVLPLG 178
            |:          |.|...|.:...|:|..:..|:          |:::.:...|.....||| |.
plant   114 KH----------SLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFNLDSWSSRVL-LM 167

  Fly   179 RMCQLYTTDVTGNLFYSLNVG----GLRRGRSELI----TKTKELFNTN-------PRKVLDFMS 228
            ...:..|.::|.....|.:.|    .||:....:|    :....||:|.       .|||.:.::
plant   168 EEAKKITFELTVKQLMSFDPGEWSESLRKEYLLVIEGFFSLPLPLFSTTYRKAIQARRKVAEALT 232

  Fly   229 VFFLPKWTGVLKPKVFTEDYARYMRHLVDDHHEPTKGDLINQLQHFQLSRSSNHYSQHP--DFVA 291
            |.       |:|.:...|:.|.            .|.|::     ..|..:.:.:|...  ||:.
plant   233 VV-------VMKRREEEEEGAE------------RKKDML-----AALLAADDGFSDEEIVDFLV 273

  Fly   292 SQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSE---LREAFISTATLSYDTLMTLPYLKM 353
            :    :|:||:||:|.:|...:..|.:.|....:|:.|   :|.....:.:|.:....::|:.:.
plant   274 A----LLVAGYETTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEWSDYKSMPFTQC 334

  Fly   354 VCLEALRLYPAAAFV-NRECTSSASEGFSLQPHVDFIVPPGMPAYISILGLHRDERFWPEPCVFD 417
            |..|.||:......| .|..|....:|:.        :|.|...:.|...:|.|...:.:...|:
plant   335 VVNETLRVANIIGGVFRRAMTDVEIKGYK--------IPKGWKVFSSFRAVHLDPNHFKDARTFN 391

  Fly   418 PERF-------GPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY-WV 467
            |.|:       ||..       .:.|||.||..|.|..|..:.|.:.:..::..: ||
plant   392 PWRWQSNSVTTGPSN-------VFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWV 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 102/484 (21%)
CPDNP_196188.1 p450 1..472 CDD:386267 111/513 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.